PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G34270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MIKC_MADS
Protein Properties Length: 267aa    MW: 29641.4 Da    PI: 8.6436
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G34270.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.91.3e-28959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krienk+ rqvtf+kRrng+lKKA+EL +LCdae+a+iifss+g+l+e+s+
  LPERR01G34270.1  9 KRIENKTSRQVTFCKRRNGLLKKAYELAILCDAEIALIIFSSRGRLFEFSN 59
                     79***********************************************95 PP

2K-box107.31.8e-35841759100
            K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                       + + +++ qqe ak++ +i++Lq+ +Rhl+Ge +++++ keL++Le++Lek++++iR+kK++ll+++ie++qk+e +l++en+ Lr+k++e
  LPERR01G34270.1  84 IDVNSHQYFQQETAKMRHQIQTLQNANRHLMGEAIGNMTAKELKSLENRLEKGISRIRAKKHDLLFSEIEYMQKREADLHNENMFLRAKVAE 175
                      667889***********************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.955161IPR002100Transcription factor, MADS-box
SMARTSM004322.0E-40160IPR002100Transcription factor, MADS-box
CDDcd002652.31E-43276No hitNo description
SuperFamilySSF554551.44E-30275IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.2E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-313859IPR002100Transcription factor, MADS-box
PfamPF014861.3E-2886173IPR002487Transcription factor, K-box
PROSITE profilePS5129714.73589179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048438Biological Processfloral whorl development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MGRGKIEIKR IENKTSRQVT FCKRRNGLLK KAYELAILCD AEIALIIFSS RGRLFEFSNV  60
NSTRSTIERY KKASDSTSGS APVIDVNSHQ YFQQETAKMR HQIQTLQNAN RHLMGEAIGN  120
MTAKELKSLE NRLEKGISRI RAKKHDLLFS EIEYMQKREA DLHNENMFLR AKVAEAERAD  180
EQAAAEDEMA AAAGGSSGAE LEALPATFGD TREYLYPPAP PHASILAAAA AVQYSSSEHS  240
HGGHHHQQTA LHLGYFKVDD SAGKGLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S7e-20168168Myocyte-specific enhancer factor 2B
1tqe_R7e-20168168Myocyte-specific enhancer factor 2B
1tqe_Q7e-20168168Myocyte-specific enhancer factor 2B
1tqe_P7e-20168168Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0709580.0AK070958.1 Oryza sativa Japonica Group cDNA clone:J023065L09, full insert sequence.
GenBankAY5519130.0AY551913.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS207 mRNA, complete cds.
GenBankFJ7509440.0FJ750944.1 Oryza sativa clone KCS020C02 MADS-box transcription factor 21 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006645140.11e-153PREDICTED: MADS-box transcription factor 21 isoform X2
SwissprotQ8RU311e-152MAD21_ORYSJ; MADS-box transcription factor 21
TrEMBLA0A0D9V8Q90.0A0A0D9V8Q9_9ORYZ; Uncharacterized protein
STRINGOB01G48510.11e-152(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.11e-85MIKC_MADS family protein